TCDB is operated by the Saier Lab Bioinformatics Group
>Q9JJV3|CCGL_MOUSE Voltage-dependent calcium channel gamma-like subunit - Mus musculus (Mouse).
MTAIGAQAHKLLGLKRPHRSFFESFIRTLIIVCTALAVVLSSVSICDGHWLLVEDHLFGLWYFCTIGNHSEPHCLRDLSQ
AHMPGLAVGMGLARSVAAMAVVAAIFGLEMLIVSQVCEDVRSRRKWAIGSYLLLVAFILSSGGLLTFIILLKNQINLLGF
TLMFWCEFTASFLFFLNAASGLHINSLTQPWDPPAGTLAYRKRGYDGTSLI