TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9K0M2|Q9K0M2_NEIMB Putative uncharacterized protein OS=Neisseria meningitidis serogroup B (strain MC58) GN=NMB0570 PE=4 SV=1
MRHLPLFSLMLFPASVYAADLDGANLNLLWGLPFALILLSIALGPLFFSHTWHHHYGKITAFWTLLFLIPFSLVFGASAG
IHTVAHALVEEYIPFILLLLALYTISGGILVWGDLNGTPKLNTALLAVGTALASIMGTTGAAMLMIRPLLKANQNRTRRV
HIVIFFIFLVANIGGGLTPLGDPPLFLGFLKGVDFMWTVKHMFAPVLISTAVLLTAFYFIDNRFFKQESIAQDTPAQQEK
PEKIAIFGKWNFLLLSGVVGAVLMSGLWKPEHPGFEILGSRYALQNLVRDVILIALTAVSMAITPKQVRAGNEFNFEPIA
EVGKLFLGIFITIFPVLSILKAGEAGALGGVVSLVHDTAGHPINVMYFWMSGILSAFLDNAPTYLVFFNMAGGDAQALMT
GTLFHSLLAVSMGSVFMGALTYIGNAPNFMVKAIAEQRGVPMPTFFGYMMWSVAFLTPVFIVHTLIFFVFKLL