TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9KIJ3|MTSA_STRMU Metal ABC transporter substrate-binding lipoprotein OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=sloC PE=3 SV=2
MKKLSLLLLVCLSLLGLFACTSKKTADKKLTVVATNSIIADITKNIAGNKVVLHSIVPVGRDPHEYEPLPEDVKKTSQAD
VIFYNGINLENGGNAWFTKLVKNAHKKTDKDYFAVSDSVKTIYLENAKEKGKEDPHAWLDLKNGIIYAKNIMKRLSEKDP
KNKSYYQKNFQAYSAKLEKLHKVAKEKISRIPTEKKMIVTSEGCFKYFSKAYDIPSAYIWEINTEEEGTPNQIKALVKKL
RKSRVSALFVESSVDDRPMKTVSKDTGIPIAAKIFTDSVAKKGQAGDSYYAMMKWNIDKIANGLSQ