TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9KYG0|Q9KYG0_STRCO Putative membrane protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO2712 PE=4 SV=1
MTEPLTQSPAAPATDDGPAPPARPRRVRAVLRRVPRRLRSLPPWSPLAAGVLAGGLLGAGYGLLTTPQYTATGYVVAVPA
DQSDPASALGFAQAYGRVATQLAVLGDAQMWAHVPVATLERSVRTATSPDAPMVSVTATSADPEEAADMANAVARALTRH
AADSADDTHVELRQFARATEPTEPSSASTAVTGLVGASAGGLLGGLALLVRPRRAAREPGRAAAPVPGPAPAADVRGQL