TCDB is operated by the Saier Lab Bioinformatics Group
>Q9L178|Q9L178_STRCO Possible binding-protein-dependent transport lipoprotein - Streptomyces coelicolor.
MRRLLLTAAATTAAALTLAACGTTEPAADKAEKKASEAITLKDGKGTEVKLDGPATKVVATEWNVVESLVSLGVDPVGVA
DVKGYKTWDSAVPLKNEPKDIGTRGEPSMDTVASLAPDLIVATTDLAPAAVKQLREVAPVIEVKSADGTGQIDRMLENVD
LIAEATGTTDRAKSLREGFETKVAEGKKALADAGMAGKDIAFADGYVASNQVSIRPYTATSLIGEVNEAVGLKNAWTVKG
DEAYGLGATDVEGLTKLPEDTQFAYIGNDDDPSATPFTGELAKNPVWKSLPFVKAGDVHRLDDGIWMFGGPGSMEAYIDA
VVGALTK