TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9LF50|MEX1_ARATH Maltose excess protein 1, chloroplast precursor (Root cap protein 1) - Arabidopsis thaliana (Mouse-ear cress).
MEGKAIATSLGGDRVLIFPCSPRSSFVFTSRLSSLPLKRASIGGAVSCSGVNGLTRWNSIVSTRRLVPVRSINSESDSDS
DFPHENQQGNPGLGKFKEYQEWDSWTAKFSGGANIPFLMLQLPQIILNTQNLLAGNNTALSAVPWLGMLTGLLGNLSLLS
YFAKKREKEAAVVQTLGVVSTHIVLAQLTMAEAMPIQYFVATSAVVTIGLIVNCLYYFGKLSKTVWQLWEDVITIGGLSV
LPQIMWSTFVPLVPNSILPGTTAFGIAVAAIIMARTGKLSEKGVRFVGSLSGWTATLMFMWMPVSQMWTNFLNPDNIKGL
SSITMLLSMMGNGLMIPRALFIRDLMWLTGSLWATLFYGYGNILCLYLVNCTSQSFFVAATIGLISWIGLALWRDAVAYG
HNSPFRSLKELVFGP