TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9LIC2|Q9LIC2_ARATH Multispanning membrane protein-like OS=Arabidopsis thaliana GN=TMN7 PE=4 SV=1
MKKTKGSSFRFYATLLLSFLSFSLSRAFYLPGVAPRDFQKGDPLYVKVNKLSSTKTQLPYDYYYLNYCKPPKILNNAENL
GEVLRGDRIENSVYTFQMLEDQPCKVGCRVKLNADSTKNFKEKIDDEYRANMILDNLPVAVLRQRRDGSQSTTYEHGFRV
GFKGSYEGSKEEKYFIHNHLSFRVMYHRDQESDSARIVGFEVTPNSILHEYKEWDEKNPQLTTCNKDTKNLIQGNTVPQE
VEQGKEIVFTYDVSFKESEIKWASRWDTYLLMNDDQIHWFSIINSLMIVLFLSGMVAMIMMRTLYKDISNYNQLETQDEA
QEETGWKLVHGDVFRPPVNSGLLCVYVGTGVQIFGMSLVTMMFALLGFLSPSNRGGLMTAMVLLWVFMGIFAGYSSSRLH
KMFKGNKWKRMTLKTAFMFPGILFAIFFVLNALIWGEQSSGAIPFGTMFALFCLWFGISVPLVFVGSYLGYKKPAIEDPV
KTNKIPRQVPEQPWYMKPVFSILIGGILPFGAVFIELFFILTSIWLNQFYYIFGFLFIVFLILIVTCAEITVVLCYFQLC
SEDYNWWWRAYLTAGSSAFYLFLYSIFYFFTKLEITKLVSGMLYFGYMIIISYAFFVLTGTIGFYACFWFVRKIYSSVKI
D