TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9LQU4|PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana GN=PCR2 PE=1 SV=1
MEAQHLHAKPHAEGEWSTGFCDCFSDCKNCCITFWCPCITFGQVAEIVDRGSTSCGTAGALYALIAVVTGCACIYSCFYR
GKMRAQYNIKGDDCTDCLKHFCCELCSLTQQYRELKHRGYDMSLGWAGNVERQQNQGGVAMGAPVFQGGMTR