TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9LSR8|LRK19_ARATH L-type lectin-domain containing receptor kinase I.9 OS=Arabidopsis thaliana GN=LECRK19 PE=1 SV=2
MARWLLQILIISSLHLSSVSSQQETSFVYESFLDRQNLYLDKSAIVLPSGLLQLTNASEHQMGHAFHKKPIEFSSSGPLS
FSTHFVCALVPKPGFEGGHGIVFVLSPSMDFTHAESTRYLGIFNASTNGSSSYHVLAVELDTIWNPDFKDIDHNHVGIDV
NSPISVAIASASYYSDMKGSNESINLLSGNPIQVWVDYEGTLLNVSVAPLEVQKPTRPLLSHPINLTELFPNRSSLFAGF
SAATGTAISDQYILWWSFSIDRGSLQRLDISKLPEVPHPRAPHKKVSTLIILLPVCLAILVLAVLAGLYFRRRRKYSEVS
ETWEKEFDAHRFSYRSLFKATKGFSKDEFLGKGGFGEVYRGNLPQGREIAVKRVSHNGDEGVKQFVAEVVSMRCLKHRNL
VPLFGYCRRKRELLLVSEYMPNGSLDEHLFDDQKPVLSWSQRLVVVKGIASALWYLHTGADQVVLHRDVKASNIMLDAEF
HGRLGDFGMARFHEHGGNAATTAAVGTVGYMAPELITMGASTGTDVYAFGVFMLEVTCGRRPVEPQLQVEKRHMIKWVCE
CWKKDSLLDATDPRLGGKFVAEEVEMVMKLGLLCSNIVPESRPTMEQVVLYLNKNLPLPDFSPYTLGIGTFAPVLVDASS
LVVSSASWSLSGPSMSSSSPNHSPYAWQSTDQPWGQTIDTKNSLHIVAEPEKPSPAVKMVTLPAEDPQSNHSSISSQRVQ
PVKREKRRLHQILVAFPWINKQYFKLGLPKHIVHVSLFFFLQLARL