TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9LUH2 Aberrant lateral root formation 5 (Hypothetical 51.9 kDa protein) - Arabidopsis thaliana (Mouse-ear cress).
MADPATSSPLLDDHVGGEDERGRRSRSSTLVQKVIDVEEAKAQMIYSLPMILTNVFYYCIPITSVMFASHLGQLELAGAT
LANSWATVSGFAFMVGLSGSLETLCGQGFGAKRYRMLGVHLQSSCIVSLVFSILITIFWFFTESIFGLLRQDPSISKQAA
LYMKYQAPGLLAYGFLQNILRFCQTQSIIAPLVIFSFVPLVINIATAYVLVYVAGLGFIGAPIATSISLWIAFLSLGTYV
MCSEKFKETWTGFSLESFRYIVINLTLSLPSAAMVCLEYWAFEILVFLAGVMPNPEINTSLVAICVNTEAISYMLTYGLS
AAASTRVSNELGAGNVKGAKKATSVSVKLSLVLALGVVIVLLVGHDGWVGLFSDSYVIKEEFASLRFFLAASITLDSIQG
VLSGVARGCGWQRLVTVINLATFYLIGMPIAAFCGFKLKFYAKGLWIGLICGIFCQSSSLLLMTIFRKWTKLNVATV