TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9LZH8|OP164_ARATH Outer envelope pore protein 16-4, chloroplastic OS=Arabidopsis thaliana GN=OEP164 PE=2 SV=1
MEEELLSAVPCSSLTVESVLRVATAGGLYGLCAGPRDARKIGLSGVSQASFVAKSIGRFGFQCGLVSGVFTMTHCGLQRY
RGKNDWVNALVGGAVAGAAVAISTRNWTQVVGMAGLVSAFSVLANCTRTENPNNTN