TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2
MEVNYCPETPLLSSNDHEAIDHKPKLTGMVSSMKSNFFADLPQKLRSKIDPENPLHLDVSKAAGLKEDEKEYYERQLATL
KSFEEVESFLARSDEYTIDEKEEEEDRAERAAQELAMQISNWANIFLLALKIYATVKSGSIAIAASTLDSLLDLMAGGIL
WFTHLSMKNVNIYKYPIGKLRVQPVGIIIFAAVMATLGFQVLLVAAEQLISNEPSEKMNHVQLIWLYSIMLSATAIKLVL
WIYCKSSRNHIVRAYAKDHHFDVVTNVLGLVAAVLANAFYWWLDPTGAILLAIYTIVNWSGTVMENAVSLIGQSAPPEVL
QKLTYLVMRQGGDNIKHVDTVRAYTFGVLYFVEVDIELPEDLPLKEAHAIGESLQIKLEELPEVERAFVHLDFECHHKPE
HSVLSTIPNDL