TCDB is operated by the Saier Lab Bioinformatics Group
>Q9M9M6|Q9M9M6_ARATH T17B22.24 protein - Arabidopsis thaliana (Mouse-ear cress).
MASNLLKALIRSQILPSSRRNFSVATTQLGIPTDDLVGNHTAKWMQDRSKKSPMELISEVPPIKVDGRIVACEGDTNPAL
GHPIEFICLDLNEPAICKYCGLRYVQDHHH