TCDB is operated by the Saier Lab Bioinformatics Group
>Q9NPA1|KCMB3_HUMAN Calcium-activated potassium channel subunit beta 3 - Homo sapiens (Human).
MDFSPSSELGFHFVAFILLTRHRTAFPASGKKRETDYSDGDPLDVHKRLPSSAGEDRAVMLGFAMMGFSVLMFFLLGTTI
LKPFMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKC
HQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQSEDVILIKKYDQMAIFHCLFWPSLTLLGGALIVGMVRLTQHLSLL
CEKYSTVVRDEVGGKVPYIEQHQFKLCIMRRSKGRAEKS