TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9NWR8|MCUB_HUMAN Mitochondrial calcium uniporter regulatory subunit MCUb OS=Homo sapiens GN=CCDC109B PE=2 SV=2
MLQRGLWPWRTRLLPTPGTWRPARPWPLPPPPQVLRVKLCGNVKYYQSHHYSTVVPPDEITVIYRHGLPLVTLTLPSRKE
RCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIFTADGNMISASTLMDILLMNDFKLVINKIAYDVQCPKREKPSNEHTAE
MEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSEAKTSGLLWAGLALLSIQGGALAWLTW
WVYSWDIMEPVTYFITFANSMVFFAYFIVTRQDYTYSAVKSRQFLQFFHKKSKQQHFDVQQYNKLKEDLAKAKESLKQAR
HSLCLQMQVEELNEKN