TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9NY35|CLDN1_HUMAN Claudin domain-containing protein 1 OS=Homo sapiens GN=CLDND1 PE=1 SV=1
MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFRYNGTVGLWRR
CITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLC
ACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTN
RKEYTLMKAYRVA