TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9RD81|Q9RD81_STRCO Putative integral membrane protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0796 PE=4 SV=1
MLEAARAALRRVKWLRDPMVVQALRSAAAASIAYVIAVRLTPDKSAAPLTAPLTALLVVQVTLYATLKMSFRRVNAVVAG
VLVAIAFSQLVGLSWWSLALIIVAALGVGHLVRAEEFTAEVAISAMLVLGVTSHGSLAWARVVETLIGAIVGLVFNLILA
PPVWVEQAGESVVGLARQVRQLLLRMGEEAAGSTPFHQAAARLHEARRLDHDIGEVDEDLRQAEDSLRFNPRVREGLLHR
VVLRTGLDTLEICTVVMRVLARSFTDLAKEREPEPLFAPETGAAVQQLLSEIADAVVSFSVLVTSNASENAESAEERLAT
ELRQAAATRDRLADLLLEEVRRDATQWQLRGAVLAEVNRIIDEMDTEHRSRRLLEELDRHTREQRERMPRLTRLRDRARD
RLRAGPRRRNRDTAARRSS