TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9REG6 HBL B PROTEIN (HEMOLYSIN BL (HBL) BINDING COMPONENT B) (HBL) - Bacillus cereus.
MIKKIPYKLLAVSTLLTITTANVVSPVTTFASEIEQTNNGDTALSANEARMKETLQKAGLFAKSMNAYSYMLIKNPDVNF
EGITINGYVDLPGRIVQDQKNARAHAVTWDTKVKKQLLDTLNGIVEYDTTFDNYYETMVEAINTGDGETLKEGITDLRGE
IQQNQKYAQQLIEELTKLRDSIGHDVRAFGSNKELLQSILKNQGADVDADQKRLEEVLGSVNYYKQLESDGFNVMKGAIL
GLPIIGGIIVGVARDNLGKLEPLLAELRQTVDYKVTLNRVVGVAYSNINEMHKALDDAINALTYMSTQWHDLDSQYSGVL
GHIENAAQKADQNKFKFLKPNLNAAKDSWKTLRTDAVTLKEGIKELKVETVTPQK