TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9REG7 HBL L1 PROTEIN (HEMOLYSIN BL (HBL) LYTIC COMPONENT L1) (HBL) - Bacillus cereus.
MKKFPFKVLTLATLATVITATTGNTIHAFAQETTAQEQKVGNYALGPEGLKKALAETGSHILVMDLYAKTMIKQPNVNLS
NIDLGSEGGELLKNIHLNQELSRINANYWLDTAKPQIQKTARNIVNYDEQFQNYYDTLVETVQKKDKAGLKEGINDLITT
INTNSKEVTDVIKMLQDFKGKLYQNSTDFKNNVGGPDGKGGLTAILAGQQATIPQLQAEIEQLRSTQKKHFDDVLAWSIG
GGLGAAILVIAAIGGAVVIVVTGGTATPAVVGGLSALGAAGIGLGTAAGVTASKHMDSYNEISNKIGELSMKADRANQAV
LSLTNAKETLAYLYQTVDQAILSLTNIQKQWNTMGANYTDLLDNIDSMEDHKFSLIPDDLKAAKESWNDIHKDAEFISKD
IAFKQE