TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9S5Y1|Q9S5Y1_THEMA Maltose ABC transporter, periplasmic maltose-binding protein - Thermotoga maritima.
MVKRLLVLMLVVVSALVLSQTKLTIWCSEKQVDILQKLGEEFKAKYGIPVEVQYVDFGSIKSKFLTAAPQGQGADIIVGA
HDWVGELAVNGLIEPIPNFSDLKNFYDTALKAFSYGGKLYGVPYAMEAVALIYNKDYVDSVPKTMDELIEKAKQIDEEYG
GEVRGFIYDVANFYFSAPFILGYGGYVFKETPQGLDVTDIGLANEGAVKGAKLIKRMIDEGVLTPGDNYGTMDSMFKEGL
AAMIINGLWAIKSYKDAGINYGVAPIPELEPGVPAKPFVGVQGFMINAKSPNKVIAMEFLTNFIARKETMYKIYLADPRL
PARKDVLELVKDNPDVVAFTQSASMGTPMPNVPEMAPVWSAMGDALSIIINGQASVEDALKEAVEKIKAQIEK