TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9SI03|MTP12_ARATH Metal tolerance protein 12 OS=Arabidopsis thaliana GN=MTP12 PE=3 SV=1
MESPESFSTMFMKPIRHILSEKKSRKIALFLLINTAYMVVEFVAGFMSNSLGLISDACHMLFDCAALAIGLYASYISRLP
ANHQYNYGRGRFEVLSGYVNAVFLVLVGALIVLESIERILDPQEISTNSLLVVSVGGLLVNIVGLIFFHEEHHHAHGGSG
IFLHVLADTMGSVGVVISTLLIKYKGWLVADPASSIFISILIIASVIPLLRNSAEILLQRVPRAHRQDLKEAMRNILKTK
GVCSIQRLHVWSFTNSDVVATLHLLVSADSDKTDTKLQVSRLLEDAGVKDWTLQVESVNS