TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9SIA3|DTX4_ARATH Protein DETOXIFICATION 4 OS=Arabidopsis thaliana OX=3702 GN=DTX4 PE=3 SV=2
MEEPFLPQDEQIVPCKATWKSGQLNVELKKVSRLAVPMATVTIAQYLLPVISVMVAGHNGELQLSGVALATSFTNVSGFS
IMFGLVGSLETLSGQAYGAKQYEKMGTYTYSAISSNIPICVLISILWIYMEKLLISLGQDPDISRVAGSYALRLIPTLFA
HAIVLPLTRFLLAQGLVLPLLYFALTTLLFHIAVCWTLVSALGLGSNGAALAISVSFWFFAMTLSCYVRFSSSCEKTRRF
VSQDFLSSVKQFFRYGVPSAAMLCLEWWLFELLILCSGLLQNPKLETSVLSICLTTATLHYVIPVGVAAAVSTRVSNKLG
AGIPQVARVSVLAGLCLWLVESSFFSILLFAFRNIIGYAFSNSKEVVDYVADLSPLLCLSFVLDGFTAVLNGVARGCGWQ
HIGALNNVVAYYLVGAPVGIYLAFSCELNGKGLWCGVVVGSAVQAIILAIVTASMNWKEQAKKARKRLISSENGLA