TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9U298|ACH8_CAEEL Neuronal acetylcholine receptor subunit eat-2 OS=Caenorhabditis elegans OX=6239 GN=eat-2 PE=2 SV=1
MTLKIAFFTLILLVSIERVYSSDEEYRLLKDLREGYDPVERPVADHRKPVNVKLRLILQQLVDVDERNQVITLVVWNQYT
WNDYKLRWSPEEYGNITTLQIPHGTLWKPDILLFNSANEHFDASFPVHMVVSSNGDVLFAPPGIVSFSCSLSMTWFPYDQ
QVCYLKFGSWTYGKKLDLQIDDSDLPDGHKMDLQYYIPNGEFDLLATPAFRKSTTFLDETYVELYFHMHLKRRTMYYGLN
WIVPSILISLSNILGFTMPPECGEKITLQITNFLSVMVFLAMVSEVAPPTSESIPIIAAFFSLSIVILGLSICASLIIVN
IFFRHPKTHRMGDWTRYVFLEWLPWFLLMSRPEHTFCRPRREEEKNDEEAGGDGTKLLENQQHQPRPRLLVNSQLVMDST
VPYLEEIIGYLKVFKAKLDDDEEEEEEILNWRFMAMVIDRLSLFLFTGLIFGTTALIFAFCPNLFTDSPIVDIE