TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9U4L6|TO401_DROME Mitochondrial import receptor subunit TOM40 homolog 1 OS=Drosophila melanogaster GN=Tom40 PE=2 SV=2
MGNVLAASSGAPGSGASNLGLGLQEPAPLPSNSGSLTESSSSAEGLDSLAAAKDAALENPGTVEELHKKCKDIQAITFEG
AKIMLNKGLSNHFQVSHTINMSNVVPSGYRFGATYVGTKEFSPTEAFPVLLGDIDPAGNLNANVIHQFSARLRCKFASQI
QESKVVASQLTTDYRGSDYTLSLTVANPSIFTNSGVVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTAG
SSVWSGTLGQSGLHVCYYQKASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKRLAPLPF
TLALSGRMNHVKNNFRLGCGLMIG