TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9UKY0|PRND_HUMAN Prion-like protein doppel OS=Homo sapiens GN=PRND PE=1 SV=2
MRKHLSWWWLATVCMLLFSHLSAVQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEA
NYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGAGLRVTMH
QPVLLCLLALIWLTVK