TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9VDL7|Q9VDL7_DROME Alternative testis transcripts open reading frame A, isoform A OS=Drosophila melanogaster GN=att-ORFA PE=2 SV=2
MSRLLEKPNIAMSIKSTGSQLSSTMTTASATLSSDLDDADTSRTQLSPSETSGVVLVPATTVTPMRQKIDQVVISLISGA
AAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHV
DKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAG
TSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEG
VKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLTELANLRRVEK