TCDB is operated by the Saier Lab Bioinformatics Group
>Q9VT04|Q9VT04_DROME CG3424-PA, isoform A - Drosophila melanogaster (Fruit fly).
MVNIVDSGSKHAPQEMEQFLPGEGKVMYKIQPRKSDTEQALAGNDFDPFALRDNPHPTTDNETLTHLLKASLGTGILGMP
FAFMCSGLIMGIFSTIFTAFICTHCSYVLVKCGHKLYYRTRRTKMTFAEIAEAAFQKGPKWCRGFAPVAKFSILFGLFLT
YFGTCSVYTVIVASNFEQLISYWTGTAVSLRMLICIMLVPLILIAWVPNLKYLAPVSMVANVFMGLGLGITFYYLVQDLP
PVEERESVVWSTLPQFFSITIFAMEAIGVVMPLENNMKTPQSFLGICGVLSQGMSGVTLIYMLLGFLGYLRYGSATGESI
TLNLPIEEWPAQTVKVLISLAVYCTFGLQFFVCLEIIWDGIKEKCKKRPTLVNYVLRTVLVTAAVVLAVAVPTIGPFMGL
IGAFCFSILGLIFPVVIELIVHWESGFGKYNWILWKNAIITLCGIGALVFGTQAAIKDIVKAYSNNENVGE