TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9WTW1|GRIP2_RAT Glutamate receptor-interacting protein 2 OS=Rattus norvegicus GN=Grip2 PE=1 SV=1
MLAVSLKWRLGVVRRRPKDDGPYSKGGKDTAGTDGALVCRRQSIPEEFRGITMVELIKREGSTLGLTISGGTDKDGKPRV
SNLRPGGLAARSDLLNVGDYIRSVNGIRLTRLRHDEIITLLKNVGERVVLEVEYELPPPAPENNPRIISKTVDVSLYKEG
NSFGFVLRGGAHEDLHKSRPLVLTYVRPGGPADREGSLKVGDRLLSIDGIPLHGASHATAIATLQQCSHEALFQVEYDVA
TPDTVANASGPLVVEIAKTPGSALGISLTTGSHRNKPAITIDRIKPASVVDRSGALHAGDHILAIDGTSTEHCSLVEATK
LLASVTEKVRLEILPAPQSRRPLKPPEAVRIQRSEQLHHWDPCVPSCHSPRPSHCRAPTWAPGGQDQSRSVSSTPFSSPT
MNPAFPCANASTLPRGPMSPRTTAGRRRQRRKEHRSSLSLASSTVGPGGQIVHTETTEVVLCGDPLSGFGLQLQGGIFAT
ETLSSPPLVRFIEPDSPAERCGLLQVGDRVLAINGIATEDGTMEEANQLLRDAALARKVVLEIEFDVAESVIPSSGTFHV
KLPKRRGVELGITISSASRKRGEPLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDHCPMEYAVQILRQCEDLVKLKIR
KDEDNSDEQESSGAVSYTVELKRYGGPLGITISGTEEPFDPIIISGLTKRGLAERTGAIHVGDRILAINSVSLKGRPLSE
AIHLLQVAGETVTLKIKKQLDRPLLPRQSGSLSEASDVDEDPPEALKGGLLTTHFSPAVPSVDSAVESWGSSATEGGFGG
SGSYTPQVAVRSVTPQEWRSSRLKSSPPPLEPRRTSYTPGPTDESFPEEEEGDWEPPMSPAPGPAREEGFWRVLGEALED
LESCGQSELLRELEASIMTGTVQSVAVDGRPGSRPWRRSREVGTSPEDLQELLLPTPLEMHRVTLHKDPVRNDFGFSVSD
GLLEKGVYVHTVRIDGPAQHGGLQPFDRLLQVNHVRTRDFDCCLAVPLLAEAGDILELVVSRNPLAQSRRTPGAPGPSSP
QMI