TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9WXN6|Q9WXN6_THEMA Oligopeptide ABC transporter, permease protein - Thermotoga maritima
MFRTMIRPLFKNKKFIIGFSIFLFFLFLGIFGPMFYRVDPTEMTWDYEQPPSSAHPLGTDTYGRDVLAQLLHGIRSSLYI
GFLAAIISLVIGTIIGSFSAVKRGIVDDVLMGITNIVLTTPSILIAILIASYLKVRSVEMVAVILGLFQWPWFARAIRAQ
LMSVMSREYVYLSVMAGYSDLRLVIEDLIPTIATYAFMSFVLFINGGIMGEAGLSLIGLGPTQGISLGIMLQWAVLMEAV
RRGLWWWFVPPGLAIVAVTASLLVISTAMDEVFNPRLREE