TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9WYP9|Q9WYP9_THEMA Extracellular solute-binding protein family 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0418 PE=4 SV=1
MRKFLMTIVLMVSLLIFAEEITITAWTVGPDNPSYYRFDNLKTAAERLNKILKDLGVDLTIKVDGYFDTTDWSSFKQKVV
FGIKSGQTVDIICSGHDDIGAWAKAGYIIPLDEYVKKYWDEVYYDFIPSLWESTKYKGQIYGIPQDTEARPFYINKQVLK
KLGWSDEEINSLPDRIARGEFTFEDFIEVAREAIEKGLVEWGLYHRPKAGIDYYQLMISMGIDFYDEEKAVFVYNVEEMK
DYYKLLYDLANTYKILPKNMIGTPWTSVHKDVTGGKVLAWMGGTWNWAEWKKDYGKTEEELQEMFILAPVPKFRDRGRPN
TLSHPVVYMIPSTSKYPDIAFLLITLASAPELNMRHAVESGHLPIRWQQTVLPEYTKEFIMMEGTKLLPYSGFIPNDDMF
NLYNQIIFEGMQMAESGMNPEKVAEDVAKRLKSQLKDRVVIIE