TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9WYQ0|Q9WYQ0_THEMA ABC-type transporter, integral membrane subunit OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0419 PE=3 SV=1
MKKLKPWLLLSPLLIFVIIFFVIPVILTVVIAFTDMDYSFTWNFVGFQNFKDISTDFIIPRVIANTFIYTFGTLGLFNLG
TALLLSLLTTSISDRWGNFFRTLWMLPRLTPSVVYGLLWLWMFDPTEYGLVNFIRGLFGLPPQDWLHSAPMWMIIFANGF
IGASMGMLVFTAAIKSIPEDYYRAARIDGASWFMIVRKITLPLIKWHLLFVTAYQTLSLLASFEYILIITDGGPVYRTEV
WALYTYHNAFSHFRFGYGAALSIILVIIGVISAFVYMKFFGFESLMEKPKVEVE