TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9X0T0|Q9X0T0_THEMA Maltose ABC transporter, permease protein - Thermotoga maritima.
MKNIVKLFLWFLLAILNIALFWAGVFLFQNEYYELSIVLFSLLVLIDFFIINPRGYPYRYTIPALILLFVLVLYPIYFTF
KVAFTNYGTGHFMSRQEAIERLLYDPNFSYVVDSTPVSYKVFVVYDGLSPTDDFLILFKTGDTIFLGERPKPVVARGQEV
LLSQFNLVPITGETISLNGDTFRIVPWPADLSEINLVVRGEKTYKSFYSPDDEILRLNAPYFKSRIAQGYLVNAEYVLPD
GKKLALRIAPDGEWRFMYVERLYRLAYKEIYDGVKMKITTTVVNNLTGREVVEREGAFYDVDENGNETFLVGFIDFVGWK
NFLRIVKDPKVSGPFFRIFLWTFVWAVLSVVLSLAVGLPFALVLNNPRLKGRNLYRTLLIIPWAIPVFISALVWRNGLLN
ESYGVINKFLLPLFGLEPIKWFNDPFWARVGVLLVNVWLTFPYMMTISLGALQSIPPELYEVAAIDGAGRFRRFVHITFP
LLMTIIAPLLVSSFAFSFNNFTIIYLITGGGPPIPNSTTPTGYTDILISYVYKLAFEGGQGQDFGFASAISILIFFLVGG
ISFVNFKLSGAFEEVSR