TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9X0U6|Q9X0U6_THEMA Oligopeptide ABC transporter, ATP-binding protein - Thermotoga maritima
MSLLKVQNLTKEFPLGFFGKERLKAVDDVSFEIERSRIVSLIGESGSGKTTVGKLILKLIRPSSGQILLNGRDITQIKGR
ELREYYRKVQGVFQDPFSSFNPIYKIDRVLDMVFEEFFPDTPASERRTKMEEVIASVGMNPREILGKYPHQLSGGQLQRI
LIARTLLLNVELLIADEIISMLDASTRVDILNLLGDLRERGMSVIFITHDLSLGYYISDETFIMYRGNIVEMGDTEKVFH
NPIHPYTKMLLESVPEIDRKWDLSKRFIPELVSSSNAPCKYYDRCPIRDERCLVQKPAMVEVEENHKVLCLKAGD