TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9X0U8|Q9X0U8_THEMA Oligopeptide ABC transporter, permease protein - Thermotoga maritima
MTRKEFVHFFLKNKKVIFAICVYAGLIILALVGPYLSPYKDPLAFVGPGYQPPSKEHWLGTNTFGQDIFTQLVYGLRSSL
FVGVLGGTLATVIGLLIGFVAGYKGGWFDELLMMFTNILMVIPTLALLIIIAAYLPYRGVFIESIIIGLTAWPWTARAVR
AQTLSLKTREFVDLARITARKPMKIIFGEIMPNMMSYVFMVFILQFGGAILAATGLDFIGLGPTRGISLGIMMQQATLWN
AIQLGMWWWAITPGAVITLMVATLYVMNAGLDEVFNPKLREM