TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9X1G6|Q9X1G6_THEMA Membrane protein-like protein OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1455 PE=4 SV=1
MSSIKKISFVGIFSALATLVMFLEFPIFPQASFLKYDPSEIPALIVSFLLGPGVGMFVVLVKDILFFLMKSGDPVGIAMN
AVLGMSFVGIAGLIYHRNKSRATAIKGMIVATLFATAFALGLNALIVPLYFEAPFELYLKFFPFILAFNLVKFGIDSVVT
FFVYKKVSSILKLETVEGRSNNG