TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9X1Z1|ECFA_THEMA Energy-coupling factor transporter ATP-binding protein EcfA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA PE=3 SV=1
MKITLNSVSFRYNGDYVLKDVNAEFETGKIYVVVGKNGSGKTTLLKILAGLLEAEGEIFLDGSPADPFLLRKNVGYVFQN
PSSQIIGATVEEDVAFSLEIMGLDESEMRKRIKKVLELVGLSGLEKEDPLNLSGGQKQRLAIASMLARDTRFLALDEPVS
MLDPPSQREIFQVLESLKNEGKGIILVTHELEYLDDMDFILHISNGTIDFCGSWEEFVEREFDDVEIPFKWKLWKKCGKI
NLWEDRYENSGNQRRRDTV