TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9X9U1|Q9X9U1_STRCO Putative membrane protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3927 PE=4 SV=1
MTTPQPPSFPPRRPRRGPNAEEGDGRAAGHAPGVASEANAGRHETGYGHDADHGYDAGGGRGAGGGHGASSGHGAGGGHG
HSHSHGPAAPVSRHLRKVIAAILIPFTAAVLVGLAVLWPGGAPSHERTGVGFDRQTQQATVTKVVELSCQSVNASGGVPT
GDTSTAEGSSAVQQAKGDCKRATIRVDTGHDKGRTFEEIVQPDQSRQLHEGQQVVVAYEPSAPKDLQYSVTDINRRLPLA
LLAGIFALAVVVVGRLRGLMALVSLAISFLLLNFFILPAILQGSNPLVVAVIGSSAIMLIALYLCHGLSARTSVAVLGTL
ISLLLIGVLGSLFIGWAALTGNTDDNTGLIHGLYPSIDMSGLLLAGVIIGSLGVLDDVTVTQTSAVWELHEANPTMGWRG
LYRAGIRIGRDHIASVVNTLVLAYAGAALPLLLLFSIAQSGVGTVANSELVAEEIVRTLVGSIGLVASVPVTTALAALVV
SADRPAERPAQVATAGGGASAPARGGRGRRRKR