TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9XUJ1|Q9XUJ1_CAEEL Hypothetical protein hmt-1 (Heavy metal tolerance factor 1) - Caenorhabditis elegans.
MGFSPFLDECRAEGLWPIGPSCNKIISFGVYTFFIVVNFIVLCIPNSNSANNNYRRMTDDDASSTSKLTISKILSICTIF
AVICQSIFYFCFTFYFHPYTHLLLAFCVSKLFFWILSLCSFSKWRNQPSTPISLAFAFSAALLIHCIPLTDWKKYFEPTS
KNRGDLTFYIIELALVTVVFFFTIVTGLFNFSGCSSRESAWNNLSKKVVTVAPYIWPTKSISLQLRVVFCLFLLIIGRLI
NVSLPILSKWIVDELATPDTFQYSLLFLATFLKFLQGNGAMGGFLNTVRTYLWIPIQQYTTRELEVELFKHLHSLSLRWH
LSRKTGQVLRVMDRGTSSVNNILNYILFNVVPTIADIVIAVIFFFSAFNAYFGLIVFGTMALYLTVTISITEWRTQYIRE
ANEKDNATSAIATDSLINYETVKYYGNEEFEVNRFKNAIESYQVTEWKTQASLAFLNCLQNAIIGIGMIGGSVFVVYMIV
HEKTLTVGDYVLFTTYLLQLYTPLNFFGTIYRVIQKAFVDMENMFDLMNDEVEVKDLPHALPYTDPRGTISVKNLTFEYN
TGLPVIKNISFEIGNGQTVALVGSSGSGKSTLIRLLFRLFESTEGSIEFDGIDVRNYTMHSLRQQIGIVPQDTVLFNDTI
MYNIRFGRPDASDEEVIEAAKAAMIHEKITSLPEGYATMVGERGLKLSGGEKQRVAIARTILKKPQFIFLDEATSALDTP
TERAIQKCLEKLCKSRTGVVVAHRLSTVVNADLILVLDKGIILERGNHKELLAQQGTYASMWEAQIAEQRAKSIELGEEL
P