TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9Y8Z4|Q9Y8Z4_AERPE FTR1 family protein OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_2490.1 PE=4 SV=2
MSEALATGLVAFREAFEAILLSTIIIMLLKKMGEHGKIKIVYTTAILSVVLGVALGAGIYTIFRGFPEKELVEAGMSYLA
AMVIGTVIVWGVRHGPKIKGEIEAKLASSLSAKAVAVVTFIFVFREVFETVLITAPFLVSNPSSNILGVSGGTLGALALG
VAVYWLGMRINLRTFFLGTSILLAFVASGLVGYGTHELLEWFEEEGIKLGVLGKKIQLLNVGENSLLHPKNAIGGLLSVM
VGYYHYMEIARIILQGSTLLLLLAYIIAAYKPFGKF