TCDB is operated by the Saier Lab Bioinformatics Group
>Q9Y974|Q9Y974_AERPE Putative uncharacterized protein - Aeropyrum pernix.
MSLSHLGPERKLALAAILGGLAVALSVIRIDVGPTKALPWQHMVNVVAGVTLGPWWASGLALAVGLVRMALGIGTVYSIP
GGIPGALLVGLGAVALLRLGRSPLPAGLLEPLGTAVIGFLLALYVFAPLMGDVEAWRSALTVIWLGWLSSTLIGTTLGLA
ALVALERSGVVRLRPPDSGGAGEG