TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9Y977|Q9Y977_AERPE Putative uncharacterized protein OS=Aeropyrum pernix GN=APE2408 PE=3 SV=2
MSVVRLRDVWYRYPGGGWVLRGVSLEAPRGITLLAGPTGGGKSTILRVAAGLATRIYGGYLRGEVEARGKPVLVPQDYDL
FILSLTPREELEYCYEASGLPPWEARREAVRLAEELGIEDLLDRRVSKLSAGERQRVAIASALALGAEVLLMDEPLAYQD
PLGVESLIRLLRRLDVEGVVVAEHRVHYLLPAASSVYLVYDGRAKQLGPGEAVEVLAGILEPGLRGVDGCEYGCSEG