TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9Y979|Q9Y979_AERPE Putative uncharacterized protein OS=Aeropyrum pernix GN=APE2406 PE=4 SV=2
MTVRGRLRDVTLSIPRGVTAILGANGSGKTTLLKLAARLLKPDRGSVEGPRRVGAALQNPYLGFLGPTVAEDLARTAGGR
GEALKLLREAGLEYASERSPYTLSMGEARILSVLMAISWGPEAVVIDEPTSGLDGSGKRWLASLIARLGVPVLVAGHDID
FAAAVAGWAVILRDGRVRVSGDMERVLRMLPEETGLGLEPGPAVKAALERGLDPLCTARCVLGVTR