TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9YS26|Q9YS26_9MONO Small hydrophobic protein OS=Bovine respiratory syncytial virus GN=SH PE=4 SV=1
MNNTSTIIEFTGEFWTYFTLAFMMLTIGFFFIVTSLVAAILNKLCDFNDHHTNSLDIRTRLRNDTQLITRAHEGSINQSS
N