TCDB is operated by the Saier Lab Bioinformatics Group
>Q9Z2Y3|HOME1_MOUSE Homer protein homolog 1 - Mus musculus (Mouse).
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADS
RANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNS
EPRAEPTQNALPFPHSAGDRTQALSHASSAISKHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKR
VTELECVSSQANAVHSHKTELNQTVQELEETLKVKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKDLEGQLSDL
EQRLEKSQNEQEAFRSNLKTLLEILDGKIFELTELRDNLAKLLECS