TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9Z550|Q9Z550_STRCO Putative membrane protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO6122 PE=4 SV=1
MLNALEVFTTVIVGLMVGVEFSVAFVMNRIFNALPEDSGQLARAHGGRMLGALMPFWYIGSLVLSAVWAVAGWDRSGAGL
VVIAAALLIVSVIMSLLLLVPINDRGKTWTPENRPADWKEQMNRWDRYHYVRVAVIVAAFACLVTALV