TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9ZQ34|Y2433_ARATH Uncharacterized protein At2g24330 OS=Arabidopsis thaliana OX=3702 GN=At2g24330 PE=2 SV=1
MAVGEKEHEGTVVESGGEKNDSAVVLSASGEKKTTKRKGLFSRLWNAIFRVRGDDFEKRLKNISKEEATVRNRMKRRSIT
RRNFIRNLIAFSVFFEVIAVSYAIMTTRDEDLDWKLRSFRILPMFLLPAVAFLLYSSLVGFWRMCDRRDQHTLEKLQAEM
LGKINELKERTNYYITQQLIQRYDPDPAAKAAAATVLASKLGAESGLKVFVGDESQLEPTAGKNNAKHSGGLRNRKQTNT
RGNSAETTPIHHSDNESNHSGTSERITGTEQNQQMVFEHYNPQEYAAHDGSWISRIAALLVGEDPSQSYALICGNCRMHN
GLARKEDFPYITYYCPHCRALNKPKHSEEHSLIAPADTLPKVSLKPMESEVINSSSSTSERGNSPIPLLHTPEIVEEVPE
TAENETPN