TCDB is operated by the Saier Lab Bioinformatics Group
>Q9ZR72|MDR1_ARATH Multidrug resistance protein 1 - Arabidopsis thaliana (Mouse-ear cress).
MDNDGGAPPPPPTLVVEEPKKAEIRGVAFKELFRFADGLDYVLMGIGSVGAFVHGCSLPLFLRFFADLVNSFGSNSNNVE
KMMEEVLKYALYFLVVGAAIWASSWAEISCWMWSGERQTTKMRIKYLEAALNQDIQFFDTEVRTSDVVFAINTDAVMVQD
AISEKLGNFIHYMATFVSGFIVGFTAVWQLALVTLAVVPLIAVIGGIHTTTLSKLSNKSQESLSQAGNIVEQTVVQIRVV
MAFVGESRASQAYSSALKIAQKLGYKTGLAKGMGLGATYFVVFCCYALLLWYGGYLVRHHLTNGGLAIATMFAVMIGGLA
LGQSAPSMAAFAKAKVAAAKIFRIIDHKPTIERNSESGVELDSVTGLVELKNVDFSYPSRPDVKILNNFCLSVPAGKTIA
LVGSSGSGKSTVVSLIERFYDPNSGQVLLDGQDLKTLKLRWLRQQIGLVSQEPALFATSIKENILLGRPDADQVEIEEAA
RVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLI
IAHRLSTIRKADLVAVLQQGSVSEIGTHDELFSKGENGVYAKLIKMQEAAHETAMSNARKSSARPSSARNSVSSPIMTRN
SSYGRSPYSRRLSDFSTSDFSLSIDASSYPNYRNEKLAFKDQANSFWRLAKMNSPEWKYALLGSVGSVICGSLSAFFAYV
LSAVLSVYYNPDHEYMIKQIDKYCYLLIGLSSAALVFNTLQHSFWDIVGENLTKRVREKMLSAVLKNEMAWFDQEENESA
RIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLVAVFPVVVAATVLQKMFMTGFSGDLEAAHAK
GTQLAGEAIANVRTVAAFNSEAKIVRLYTANLEPPLKRCFWKGQIAGSGYGVAQFCLYASYALGLWYASWLVKHGISDFS
KTIRVFMVLMVSANGAAETLTLAPDFIKGGQAMRSVFELLDRKTEIEPDDPDTTPVPDRLRGEVELKHIDFSYPSRPDIQ
IFRDLSLRARAGKTLALVGPSGCGKSSVISLIQRFYEPSSGRVMIDGKDIRKYNLKAIRKHIAIVPQEPCLFGTTIYENI
AYGHECATEAEIIQAATLASAHKFISALPEGYKTYVGERGVQLSGGQKQRIAIARALVRKAEIMLLDEATSALDAESERS
VQEALDQACSGRTSIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNHPDGIYARMIQLQRFTHTQVIGMTSGSSSR
VKEDDA