TCDB is operated by the Saier Lab Bioinformatics Group
>Q9ZT63|MTP1_ARATH Metal tolerance protein 1 - Arabidopsis thaliana (Mouse-ear cress).
MESSSPHHSHIVEVNVGKSDEERIIVASKVCGEAPCGFSDSKNASGDAHERSASMRKLCIAVVLCLVFMSVEVVGGIKAN
SLAILTDAAHLLSDVAAFAISLFSLWAAGWEATPRQTYGFFRIEILGALVSIQLIWLLTGILVYEAIIRIVTETSEVNGF
LMFLVAAFGLVVNIIMAVLLGHDHGHSHGHGHGHGHDHHNHSHGVTVTTHHHHHDHEHGHSHGHGEDKHHAHGDVTEQLL
DKSKTQVAAKEKRKRNINLQGAYLHVLGDSIQSVGVMIGGAIIWYNPEWKIVDLICTLAFSVIVLGTTINMIRNILEVLM
ESTPREIDATKLEKGLLEMEEVVAVHELHIWAITVGKVLLACHVNIRPEADADMVLNKVIDYIRREYNISHVTIQIER