TCDB is operated by the Saier Lab Bioinformatics Group
>Q9ZUA5|Q9ZUA5_ARATH Putative membrane protein - Arabidopsis thaliana (Mouse-ear cress).
MSSEEDKITRISIEPEKQTLLDHHTEKHFTAGEIVRDIIIGVSDGLTVPFALAAGLSGANASSSIVLTAGIAEVAAGAIS
MGLGGYLAAKSEEDHYAREMKREQEEIVAVPETEAAEVAEILAQYGIEPHEYSPVVNALRKNPQAWLDFMMRFELGLEKP
DPKRALQSAFTIAIAYVLGGFIPLLPYMLIPHAMDAVVASVVITLFALFIFGYAKGHFTGSKPLRSAFETAFIGAIASAA
AFCLAKVVQH