TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R0K6W2|R0K6W2_SETT2 Uncharacterized protein OS=Setosphaeria turcica (strain 28A) GN=SETTUDRAFT_20797 PE=4 SV=1
MACVEAPASPILIPVILLAIQLNLQPEGNLTFALSAVNDTGDTFIHLSGPTAYQWIAIGTGSRMRGSVMLIVYKNETGGI
TLSPRLAPGEIQPSYSSTIDCKLLAGGISQQPSQSTTSSSTSASSIFSADVHCTNLRSLGRDSGKISFTDSNQPFIYALG
PDSAPLTSNSVSANIQQHDSYGTFSLDMVIATSASSKSTGGQEVGVPTGSALTSSQGTSGGRGGGDGEGLDNTHAAFMLA
AFVILFPLGAVLLRYVKNGVKVHAAVQSIALVCTVMGGAIGIKLSLRSPANASFDDPHQVLGLIIFVLVFVQWGLGLVHH
LRFRRYMQPTVLGKIHRIVGPVVLLIGFVNGFLGFRMTHDEHKIKWLGGVVGVVALATTGLLVWKQVQKRSVKQDPALEM
MRK